Product Description
| Cat Number | NY-030 |
|---|---|
| Category | Peptide |
| Pack Size | 1 mg |
| Description | Endogenous agonist for the human NPY Y4 receptor |
| Modification | C-terminal amide |
| Purity | >95% |
| Biomarker Target | Neuropeptide Y receptors |
| Sequence Three Letter Code | H-Ala-Pro-Leu-Glu-Pro-Val-Tyr-Pro-Gly-Asp-Asn-Ala-Thr-Pro-Glu-Gln-Met-Ala-Gln-Tyr-Ala-Ala-Asp-Leu-Arg-Arg-Tyr-Ile-Asn-Met-Leu-Thr-Arg-Pro-Arg-Tyr-NH2 |
| Molecular Formula | C185H287N53O54S2 |
| Sl Sequence | APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY-NH2 |
| Solubility | Soluble to 0.70 mg/ml in water |
| Appearance | Freeze dried solid |
| Storage | Store dry, frozen and in the dark |
| References | Bard et al (1995) Cloning and functional expression of a human Y4 subtype receptor for pancreatic polypeptide, neuropeptide Y, and peptide YY. J.Biol.Chem. 270 26762 PMID: 7592911Batterham et al (2003) Pancreatic Polypeptide Reduces Appetite and Food Intake in Humans. J. Clin. Endocrinology Metabolism 88(8) 3989 PMID: 12915697Suzuki et al (2011) The gut hormones in appetite regulation. J Obes. 2011 528401 PMID: 21949903 Related areas All peptides >All neuropeptide Y receptor modulators >All appetite regulation research categories > |
| Note | The product is for research use only |

Share Item: