Product Description
| Cat Number | PA-020 |
|---|---|
| Category | Peptide |
| Pack Size | 1 mg |
| Description | Endogenous PAC1 receptor agonist |
| Modification | C terminal amide |
| Purity | 95% by hplc |
| Biomarker Target | PACAP receptors |
| Sequence Three Letter Code | H-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2 |
| Molecular Formula | C‚‚‚€‚ƒH‚ƒ‚ƒ‚N‚†‚ƒO‚…‚ƒS |
| Sl Sequence | HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH‚‚ |
| Solubility | Soluble to 0.90 mg/ml in water |
| Appearance | Freeze dried solid |
| Storage | Store dry, frozen and in the dark |
| References | Lazarovici et al (1998) The 38-amino-acid form of pituitary adenylate cyclase-activating polypeptide induces neurite outgrowth in PC12 cells that is dependent on protein kinase C and extracellular signal-regulated kinase but not on protein kinase A, nerve growth factor receptor Mol.Pharmacol. 54 547 PMID: 9730914Rubio-Beltrán et al (2018) PACAP38 and PAC1 receptor blockade: a new target for headache?. J Headache Pain 19 64 PMID: 30088106Pedersen et al (2019) PACAP-38 and PACAP(6-38) Degranulate Rat Meningeal Mast Cells via the Orphan MrgB3-Receptor. Front. Cellular Neuroscience 13 114 PMID: 30983973Sbei et al (2023) PACAP activates MRGPRX2 on meningeal mast cells to drive migraine-like pain. Sci Rep 13 12302 https://doi.org/10.1038/s41598-023-39571-y Related areas_x000D_ All peptides >All PACAP receptor modulators >All endocrinology research categories >All neuroscience research categories > |
| Note | The product is for research use only |

Share Item: