Product Description
| Cat Number | NU-010 |
|---|---|
| Category | Peptide |
| Pack Size | 1 mg |
| Description | Endogenous neuromedin U receptor agonist |
| Modification | C terminal amide |
| Purity | >95% by hplc |
| Biomarker Target | Neuromedin U receptors |
| Sequence Three Letter Code | H-Ile-Leu-Gln-Arg-Gly-Ser-Gly-Thr-Ala-Ala-Val-Asp-Phe-Thr-Lys-Lys-Asp-His-Thr-Ala-Thr-Trp-Gly-Arg-Pro-Phe-Phe-Leu-Phe-Arg-Pro-Arg-Asn-NH2 |
| Molecular Formula | C173H265N53O44 |
| Sl Sequence | ILQRGSGTAAVDFTKKDHTATWGRPFFLFRPRN-NH2 |
| Solubility | Soluble in water |
| Appearance | Freeze dried solid |
| Storage | Store dry, frozen and in the dark |
| References | Mori et al (2005) Identification of neuromedin S and its possible role in the mammalian circadian oscillator system. EMBO J. 24(2) 325 PMID: 15635449Mitchell et al (2009) Expression and vasoconstrictor function of anorexigenic peptides neuromedin U-25 and S in the human cardiovascular system. Cardiovasc Res. 81(2) 353 PMID: 18987052You et al (2022) Structural insights into the peptide selectivity and activation of human neuromedin U receptors. Nat Commun. 13(1) 2045 PMID: 35440625 Related areasAll peptides >All neuromedin U receptor modulators >All neuroscience research categories > |
| Note | The product is for research use only |

Share Item: