Product Description
| Cat Number | AM-040 |
|---|---|
| Category | Peptide |
| Pack Size | 1 mg |
| Description | Sole murine cathelicidin and homologue of human LL 37 |
| Modification | None |
| Purity | >95% by HPLC |
| Biomarker Target | Antibacterials,Antivirals |
| Sequence Three Letter Code | H-Gly-Leu-Leu-Arg-Lys-Gly-Gly-Glu-Lys-Ile-Gly-Glu-Lys-Leu-Lys-Lys-Ile-Gly-Gln-Lys-Ile-Lys-Asn-Phe-Phe-Gln-Lys-Leu-Val-Pro-Gln-Pro-Glu-Gln-OH |
| Molecular Formula | C178H302N50O46 |
| Sl Sequence | GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ |
| Solubility | Soluble in dilute acid and physiological buffers |
| Appearance | Freeze dried solid |
| Storage | Store dry, frozen and desiccated |
| References | Gupta et al (2015) Short, Synthetic Cationic Peptides Have Antibacterial Activity against Mycobacterium smegmatis by Forming Pores in Membrane and Synergizing with Antibiotics. Antibiotics 4(3) 358 PMID: 27025629Yoo et al (2015) Antifibrogenic Effects of the Antimicrobial Peptide Cathelicidin in Murine Colitis-Associated Fibrosis. CMGH Cellular and Molecular Gastroenterology and Hepatology. 1(1) 55 PMID: 25729764Singh et al (2013) The human antimicrobial peptide LL-37, but not the mouse ortholog, mCRAMP, can stimulate signaling by poly(I:C) through a FPRL1-dependent pathway. J. Biol. Chem. 288(12) 8258 PMID: 23386607 Related areas_x000D_ All antimicrobial peptides >All antiviral agents >All immunology research categories > |
| Note | The product is for research use only |

Share Item: